Tesamorelin Properties (PubChem)

• Molecular formula: C223H370N72O69
• Molecular weight: 5196 g/mol
• Synonym: Tesamorelin acetate
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• CAS number: 901758-09-6

Ipamorelin Properties (PubChem) 

• Molecular formula: C₃₈H₄₉N₉O₅
• Molecular weight: 711.9 g/mol
• Sequence: Aib-His-D-2-Nal-D-Phe-Lys
• CAS number: 170851-70-4

Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.  It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Tesamorelin Properties (PubChem)

• Molecular formula: C223H370N72O69
• Molecular weight: 5196 g/mol
• Synonym: Tesamorelin acetate
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• CAS number: 901758-09-6

Ipamorelin Properties (PubChem) 

• Molecular formula: C₃₈H₄₉N₉O₅
• Molecular weight: 711.9 g/mol
• Sequence: Aib-His-D-2-Nal-D-Phe-Lys
• CAS number: 170851-70-4

Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.  It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Tesamorelin Properties (PubChem)

• Molecular formula: C223H370N72O69
• Molecular weight: 5196 g/mol
• Synonym: Tesamorelin acetate
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• CAS number: 901758-09-6
• 

Ipamorelin Properties (PubChem) 

• Molecular formula: C₃₈H₄₉N₉O₅
• Molecular weight: 711.9 g/mol
• Sequence: Aib-His-D-2-Nal-D-Phe-Lys
• CAS number: 170851-70-4

Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.  It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Ipamorelin comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 5mg/vial.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

GHK-Cu comes in the form of a Lyophilized powder.  Units consist of one vial containing approximately 100mg/vial.

GHK-Cu Properties (PubChem)

• Molecular formula: C₁₄H₂₄CuN₆O₄
• Molecular weight: 402.92 g/mol
• Synonym: Copper tripeptide-1, GHK copper
• CAS number: 49557-75-7

GHK-Cu is a peptide research compound for cellular pathway studies. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

 

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

This peptide blend combines two key peptides—BPC-157, and TB-500.

This blend, often referred to as the “Wolverine Blend”, comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 20mg/vial (10mg/10mg).

BPC-157 Properties (PubChem)

• Molecular formula: C₆₂H₉₈N₁₆O₂₂
• Molecular weight: 1419.5 g/mol
• Synonym: Bepecin
• Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
• CAS number: 137525-51-0

TB-500 Properties (PubChem)

• Molecular formula: C₂₁₂H₃₅₀N₅₆O₇₈S
• Molecular weight: 4963 g/mol
• Synonym: Thymosin beta-4
• Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
• CAS number: 77591-33-4

BPC-157/TB-500 Blend is a multi-peptide research compound blend for pathway interaction studies.  It combines BPC-157 AND TB-500. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

 

• Molecular formula: C₆₂H₉₈N₁₆O₂₂
• Molecular weight: 1419.5 g/mol
• Synonym: Bepecin
• Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
• CAS number: 137525-51-0

BPC-157 (Body Protection Compound-157) is a peptide research compound for signaling pathway studies. It is in powdered form, encapsulated for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

BPC-157 comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 10mg/vial.

• Molecular formula: C₆₂H₉₈N₁₆O₂₂
• Molecular weight: 1419.5 g/mol
• Synonym: Bepecin
• Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
• CAS number: 137525-51-0

BPC-157 (Body Protection Compound-157) is a peptide research compound for signaling pathway studies. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

ARA-290 Properties (PubChem)

ARA-290 comes in the form of a Lyophilized powder.  Each unit consists of one vial containing either approximately 10mg/vial or 16mg/vial.

CJC-1295 no DAC comes in the form of a Lyophilized powder.  Each unit consists of one vial containing 10mg/vial.

CJC-1295 Properties (PubChem)

Molecular formula: C152H252N44O42
Molecular weight: 3367.9 g/mol
Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg
CAS number: 863288-34-0

CJC-1295 no DAC is a research peptide targeting GH signaling pathway studies. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.