MMP3-R comes in the form of a Lyophilized powder.  Units consist of options of one vial containing approximately 20mg/vial.

• Molecular formula: C221H343N46NaO68
• Molecular weight: 4755.0 g/mol
• Synonym: LY-3437943
• Sequence: YA¹QGTFTSDYSIL²LDKK⁴AQA¹AFIEYLLEGGPSSGAPPPS³
• CAS number: 2381089-83-2

MMP3-R is a research compound for metabolic function studies. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

MMP3-R comes in the form of a Lyophilized powder.  Units consist of options of one vial containing approximately 30mg/vial.

• Molecular formula: C221H343N46NaO68
• Molecular weight: 4755.0 g/mol
• Synonym: LY-3437943
• Sequence: YA¹QGTFTSDYSIL²LDKK⁴AQA¹AFIEYLLEGGPSSGAPPPS³
• CAS number: 2381089-83-2

MMP3-R is a research compound for metabolic function studies. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

MMP2-T comes in the form of a Lyophilized powder.  Units consist of one vial containing approximately 60mg/vial.

• Molecular formula: C₂₂₅H₃₄₈N₄₈O₆₈
• Molecular weight: 4813.527 g/mol
• Synonym: LY3298176
• Sequence: Y-Aib-E-G-T-F-T-S-D-V-S-S-Y-L-E-G-Q-A-A-K-E-F-I-A-W-L-V-K-G-R-NH2
• CAS number: 2023788-19-2

MMP2-T is a dual-pathway incretin research peptide use for metabolic studies. It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Tesamorelin Properties (PubChem)

• Molecular formula: C223H370N72O69
• Molecular weight: 5196 g/mol
• Synonym: Tesamorelin acetate
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• CAS number: 901758-09-6

Ipamorelin Properties (PubChem) 

• Molecular formula: C₃₈H₄₉N₉O₅
• Molecular weight: 711.9 g/mol
• Sequence: Aib-His-D-2-Nal-D-Phe-Lys
• CAS number: 170851-70-4

Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.  It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Tesamorelin Properties (PubChem)

• Molecular formula: C223H370N72O69
• Molecular weight: 5196 g/mol
• Synonym: Tesamorelin acetate
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• CAS number: 901758-09-6

Ipamorelin Properties (PubChem) 

• Molecular formula: C₃₈H₄₉N₉O₅
• Molecular weight: 711.9 g/mol
• Sequence: Aib-His-D-2-Nal-D-Phe-Lys
• CAS number: 170851-70-4

Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.  It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Tesamorelin Properties (PubChem)

• Molecular formula: C223H370N72O69
• Molecular weight: 5196 g/mol
• Synonym: Tesamorelin acetate
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• CAS number: 901758-09-6
• 

Ipamorelin Properties (PubChem) 

• Molecular formula: C₃₈H₄₉N₉O₅
• Molecular weight: 711.9 g/mol
• Sequence: Aib-His-D-2-Nal-D-Phe-Lys
• CAS number: 170851-70-4

Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.  It is lyophilized for stability and precise laboratory handling in a US-based cGMP manufacturing facility.  This product is intended for research purposes only and is not suitable for human or animal consumption.  3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

SS-31 Properties (PubChem)

SS-31 comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 50mg/vial.

NAD+ Properties (PubChem)

NAD+ comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 1000mg/vial.

• Molecular formula: C₂₁H₂₇N₇O₁₄P₂
• Molecular weight: 663.4 g/mol
• Synonym: Nicotinamide-Adenine-Dinucleotide
• Sequence: N/A
• CAS number: 53-84-9

Kisspeptin Properties (PubChem)

Kisspeptin comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 5mg/vial.

Ipamorelin comes in the form of a Lyophilized powder.  Each unit consists of one vial containing approximately 5mg/vial.

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.